PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj2g3v1495100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family MYB
Protein Properties Length: 344aa    MW: 38517 Da    PI: 6.6703
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj2g3v1495100.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.58.7e-201562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+lvd ++++G g+W t +++ g++R++k+c++rw +yl
  Lj2g3v1495100.1 15 KGPWTPEEDEKLVDHINKHGHGNWGTLPKRAGLNRCGKSCRLRWTNYL 62
                     79********************************************97 PP

2Myb_DNA-binding56.75.6e-1868112147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T+eE+ ++++++  lG++ W++Ia++++ gRt++++k++w+++
  Lj2g3v1495100.1  68 RGKFTEEEERIIINLHSVLGNK-WSKIAAHLP-GRTDNEIKNFWNTH 112
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.4961062IPR017930Myb domain
SuperFamilySSF466899.35E-3312109IPR009057Homeodomain-like
SMARTSM007172.0E-161464IPR001005SANT/Myb domain
PfamPF002492.4E-171562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-251669IPR009057Homeodomain-like
CDDcd001671.00E-121762No hitNo description
PROSITE profilePS5129428.61563117IPR017930Myb domain
SMARTSM007172.5E-1767115IPR001005SANT/Myb domain
PfamPF002491.7E-1668112IPR001005SANT/Myb domain
CDDcd001677.31E-1370113No hitNo description
Gene3DG3DSA:1.10.10.601.0E-2770117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MGRSPCCDNE SGVKKGPWTP EEDEKLVDHI NKHGHGNWGT LPKRAGLNRC GKSCRLRWTN  60
YLRPDIKRGK FTEEEERIII NLHSVLGNKW SKIAAHLPGR TDNEIKNFWN THIRKKLLKM  120
GIDPETHKPR TDFNHLMTLS QLLGMSTNMG NANWGNNNPL GDITQLAKLQ LLQNLMQIMG  180
SNNSLVNMGN PHNLSGIPSL NPFNVFTNTL QAKEPLVLSG EEYGNNGFCS QAQSGSPSQQ  240
DISKSWADFV DQGSYNPQVL DHNKKISSTT SCEKQEEKSS LPALVEGTFN QIDNCYNTAQ  300
TSTESPSNTN LDDWENFLID NETSGSYWKE LLDLTSTSAS PISW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-31151177108B-MYB
1h8a_C1e-301511727128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00438DAPTransfer from AT4G17785Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003533439.11e-157PREDICTED: transcription factor MYB39-like isoform X1
TrEMBLI1L4Y61e-157I1L4Y6_SOYBN; Uncharacterized protein
STRINGGLYMA09G33870.11e-156(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17785.17e-91myb domain protein 39